Mouse anti Integrin alpha 3A

Here you can find detailed information about selected products. Contact with us if you have nay questions to product or order proces.


Main information

NameMouse anti Integrin alpha 3A
Catalog numberMUB0901S
Size1 mL
Price€ 211.00


More details

CategoryPrimary Antibodies
Long descriptionIntegrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated α and β subunits. More than 18 α and 8 β subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migRation and apoptosis. For integrin subunits α3 and α6, two cytoplasmic variants, A and B, have been identified.
Antibody come from158A3 is a Mouse monoclonal IgG2a antibody derived by fusion of SP2/0 Mouse myeloma cells with spleen cells from a BALB/c Mouse immunized with a synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit α3A including an additional N-terminal cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
Other descriptionEach vial contains 1ml of culture supernatant of monoclonal antibody containing 0.09% sodium azide.
Clone158A3
Antigen-antibody binding interactionMouse anti Integrin alpha 3A Antibody
Antibody is raised inMouse
Antibody's reacts withHuman, Canine
Antibody's reacts with these speciesThis antibody doesn't cross react with other species
Antibody's specificity158A3 reacts exclusively with the cytoplasmic domain of non-phosphorylated integrin subunit a3A.
Research interestCancer,Cell adhesion
ApplicationImmunocytochemistry,Immunohistochemistry (frozen),Western blotting
Antibody's suited for158A3 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration; recommended range is 1:5 – 1:10 for immunohistochemistry with avidin-biotinylated Horseradish peroxidase complex (ABC) as detection reagent, and 1:5 – 1:100 for immunoblotting applications.
StorageStore at 4°C, or in small aliquots at -20°C.
Relevant referencesDelwel, G. O., de Melker, A. A., Hogervorst, F., Jaspars, L. H., Fles, D. L., Kuikman, I., Lindblom, A., Paulsson, M., Timpl, R., and Sonnenberg, A. (1994). Distinct and overlapping ligand specificities of the alpha 3A beta 1 and alpha 6A beta 1 integrins: recognition of laminin isoforms, Mol Biol Cell 5, 203-15. de Melker, A. A., Sterk, L. M., Delwel, G. O., Fles, D. L., Daams, H., Weening, J. J., and Sonnenberg, A. (1997). The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization, Lab Invest 76, 547-63.
Protein numbersee ncbi
WarningsThis product is intended FOR RESEARCH USE ONLY, and FOR TESTS IN VITRO, not for use in diagnostic or therapeutic procedures involving humans or animals. This product contains sodium azide. To prevent formation of toxic vapors, do not mix with strong acidic solutions. To prevent formation of potentially explosive metallic azides in metal plumbing, always wash into drain with copious quantities of water. This datasheet is as accurate as reasonably achievable, but Nordic-MUbio accepts no liability for any inaccuracies or omissions in this information.
DescriptionThe Mouse anti Integrin alpha 3A is a α- or alpha protein sometimes glycoprotein present in blood.This antibody needs to be stored at + 4°C in a fridge short term in a concentrated dilution. Freeze thaw will destroy a percentage in every cycle and should be avoided.
TestMouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
Latin nameMus musculus